Oxyntomodulin (human, mouse, rat)
| Name | Oxyntomodulin (human, mouse, rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
| Three Letter Code | {His}{Ser}{Gln}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Tyr}{Ser}{Lys}{Tyr}{Leu}{Asp}{Ser}{Arg}{Arg}{Ala}{Gln}{Asp}{Phe}{Val}{Gln}{Trp}{Leu}{Met}{Asn}{Thr}{Lys}{Arg}{Asn}{Arg}{Asn}{Asn}{Ile}{Ala} |
| Molecular Weight | 4449.900 |
| Application | DiabetesVeterinary Medicine |
| Wewer Albrechtsen, Nicolai J., et al. "Dynamics of glucagon secretion in mice and rats revealed using a validated sandwich ELISA for small sample volumes." American Journal of Physiology-Endocrinology and Metabolism 311.2 (2016): E302-E309. |
| Bagger, Jonatan Ising, et al. "Effect of oxyntomodulin, glucagon, GLP-1, and combined glucagon+ GLP-1 infusion on food intake, appetite, and resting energy expenditure." The Journal of Clinical Endocrinology & Metabolism 100.12 (2015): 4541-4552. |
| West, Graham M., et al. "Glucagon-like peptide-1 receptor ligand interactions: structural cross talk between ligands and the extracellular domain." PloS one 9.9 (2014). |
| Bak, Monika Judyta, et al. "Specificity and sensitivity of commercially available assays for glucagon and oxyntomodulin measurement in humans." Eur J Endocrinol 170.4 (2014): 529-538. |
| Albrechtsen, Nicolai J. Wewer, et al. "Hyperglucagonaemia analysed by glucagon sandwich ELISA: nonspecific interference or truly elevated levels?." Diabetologia 57.9 (2014): 1919-1926. |