(Ser⁸)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)
| Name | (Ser⁸)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HSEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ |
| Three Letter Code | {His}{Ser}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH₂ |
| Molecular Weight | 3313.680 |
| Application | Diabetes |
| Shigemori, Tomohiro, Kouichi Kuroda, and Mitsuyoshi Ueda. "Functional screening system for yeast-secreted peptides acting on G-protein coupled receptors." AMB Express 5.1 (2015): 1-7. |
| Maida, Adriano, et al. "Differential importance of glucose-dependent insulinotropic polypeptide vs glucagon-like peptide 1 receptor signaling for beta cell survival in mice." Gastroenterology 137.6 (2009): 2146-2157. |
| Kastin, Abba J., Victoria Akerstrom, and Weihong Pan. "Interactions of glucagon-like peptide-1 (GLP-1) with the blood-brain barrier." Journal of Molecular Neuroscience 18.1-2 (2002): 7-14. |
| Ritzel, U., et al. "A synthetic glucagon-like peptide-1 analog with improved plasma stability." Journal of endocrinology 159.1 (1998): 93-102. |