mCRAMP (mouse)
| Name | mCRAMP (mouse) |
| Category | Antimicrobial and Related Peptides |
| One Letter Code | GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ |
| Three Letter Code | {Gly}{Leu}{Leu}{Arg}{Lys}{Gly}{Gly}{Glu}{Lys}{Ile}{Gly}{Glu}{Lys}{Leu}{Lys}{Lys}{Ile}{Gly}{Gln}{Lys}{Ile}{Lys}{Asn}{Phe}{Phe}{Gln}{Lys}{Leu}{Val}{Pro}{Gln}{Pro}{Glu}{Gln} |
| Molecular Weight | 3878.700 |
| Application | Antimicrobial & Antiviral Peptides |
| Iimura, Mitsutoshi, et al. "Cathelicidin mediates innate intestinal defense against colonization with epithelial adherent bacterial pathogens." The journal of immunology 174.8 (2005): 4901-4907. |
| López-García, Belén, et al. "Anti-fungal activity of cathelicidins and their potential role in Candida albicans skin infection." Journal of Investigative Dermatology 125.1 (2005): 108-115. |
| Tripathi, Shweta, et al. "Antiviral activity of the human cathelicidin, LL-37, and derived peptides on seasonal and pandemic influenza A viruses." PLoS One 10.4 (2015). |
| Bergman, Peter, et al. "Induction of the antimicrobial peptide CRAMP in the blood-brain barrier and meninges after meningococcal infection." Infection and immunity 74.12 (2006): 6982-6991. |
| Saiman, Lisa, et al. "Cathelicidin peptides inhibit multiply antibiotic-resistant pathogens from patients with cystic fibrosis." Antimicrobial agents and chemotherapy 45.10 (2001): 2838-2844. |