GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat)
| Name | GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ |
| Three Letter Code | {His}{Asp}{Glu}{Phe}{Glu}{Arg}{His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH₂ |
| Molecular Weight | 4111.500 |
| Application | Diabetes |
| Bak, Monika Judyta, et al. "Specificity and sensitivity of commercially available assays for glucagon‐like peptide‐1 (GLP‐1): implications for GLP‐1 measurements in clinical studies." Diabetes, Obesity and Metabolism 16.11 (2014): 1155-1164. |
| Keane, Fiona M., et al. "Neuropeptide Y, B‐type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein‐α." The FEBS journal 278.8 (2011): 1316-1332. |
| Moreno, P., et al. "Amylin effect in extrapancreatic tissues participating in glucose homeostasis, in normal, insulin-resistant and type 2 diabetic state." Peptides 32.10 (2011): 2077-2085. |
| Duffy, Nicola A., et al. "Effects of antidiabetic drugs on dipeptidyl peptidase IV activity: nateglinide is an inhibitor of DPP IV and augments the antidiabetic activity of glucagon-like peptide-1." European journal of pharmacology 568.1-3 (2007): 278-286. |