GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat)
| Name | GLP-1 (1-37) (human, bovine, guinea pig, mouse, rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Three Letter Code | {His}{Asp}{Glu}{Phe}{Glu}{Arg}{His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}{Gly} |
| Molecular Weight | 4169.540 |
| Application | Diabetes |
| Gurlo, Tatyana, Peter C. Butler, and Alexandra E. Butler. "Evaluation of immunohistochemical staining for glucagon in human pancreatic tissue." Journal of histotechnology 39.1 (2016): 8-16. |
| Duan, Franklin F., Joy H. Liu, and John C. March. "Engineered commensal bacteria reprogram intestinal cells into glucose-responsive insulin-secreting cells for the treatment of diabetes." Diabetes 64.5 (2015): 1794-1803. |
| Edlund, Anna, et al. "CFTR and Anoctamin 1 (ANO1) contribute to cAMP amplified exocytosis and insulin secretion in human and murine pancreatic beta-cells." BMC medicine 12.1 (2014): 87. |
| Bak, Monika Judyta, et al. "Specificity and sensitivity of commercially available assays for glucagon‐like peptide‐1 (GLP‐1): implications for GLP‐1 measurements in clinical studies." Diabetes, Obesity and Metabolism 16.11 (2014): 1155-1164. |