GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat)
| Name | GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂ |
| Three Letter Code | {His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH₂ |
| Molecular Weight | 3297.680 |
| Application | Diabetes |
| Naylor, Jacqueline, et al. "Automated Acoustic Dispensing for the Serial Dilution of Peptide Agonists in Potency Determination Assays." JoVE (Journal of Visualized Experiments) 117 (2016): e54542. |
| Dods, Rachel L., and Dan Donnelly. "The peptide agonist-binding site of the glucagon-like peptide-1 (GLP-1) receptor based on site-directed mutagenesis and knowledge-based modelling." Bioscience reports 36.1 (2016). |
| Gurlo, Tatyana, Peter C. Butler, and Alexandra E. Butler. "Evaluation of immunohistochemical staining for glucagon in human pancreatic tissue." Journal of histotechnology 39.1 (2016): 8-16. |
| Waser, Beatrice, et al. "Glucagon-like-peptide-1 receptor expression in normal and diseased human thyroid and pancreas." Modern pathology 28.3 (2015): 391-402. |
| Albrechtsen, Nicolai J. Wewer, et al. "Stability of glucagon-like peptide 1 and glucagon in human plasma." Endocrine connections 4.1 (2015): 50-57. |