Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide (human)
| Name | Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide (human) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Three Letter Code | {His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH2 |
| Molecular Weight | 3297.700 |
| Application | Diabetes |
| Deacon, Carolyn F. "Circulation and degradation of GIP and GLP-1." Hormone and metabolic research 36.11/12 (2004): 761-765. |
| Williams, John A. "GLP-1." Pancreapedia: The Exocrine Pancreas Knowledge Base (2014). |
| Elahi, Dariush, et al. "GLP‐1 (9–36) amide, cleavage product of GLP‐1 (7–36) amide, is a glucoregulatory peptide." Obesity 16.7 (2008): 1501-1509. |
| Ban, Kiwon, et al. "Glucagon-like peptide (GLP)-1 (9-36) amide-mediated cytoprotection is blocked by exendin (9-39) yet does not require the known GLP-1 receptor." Endocrinology 151.4 (2010): 1520-1531. |