Glucagon - Like Peptide 1, GLP - 1 (7 - 37)

Description:

GLP-1 (7-36) amide is considered as the most important incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells.

Sequence:

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG

General

References

Comments (0)

Name	Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Category	Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2)
One Letter Code	HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Three Letter Code	{His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}{Gly}
Molecular Weight	3355.700
Application	Diabetes

Zheng, Huiyuan, Li Cai, and Linda Rinaman. "Distribution of glucagon-like peptide 1-immunopositive neurons in human caudal medulla." Brain Structure and Function 220.2 (2015): 1213-1219.

Bak, Monika Judyta, et al. "Specificity and sensitivity of commercially available assays for glucagon‐like peptide‐1 (GLP‐1): implications for GLP‐1 measurements in clinical studies." Diabetes, Obesity and Metabolism 16.11 (2014): 1155-1164.

Coopman, Karen, et al. "Residues within the transmembrane domain of the glucagon-like peptide-1 receptor involved in ligand binding and receptor activation: modelling the ligand-bound receptor." Molecular endocrinology 25.10 (2011): 1804-1818.

Zapadka, Karolina L., et al. "A pH-induced switch in human glucagon-like peptide-1 aggregation kinetics." Journal of the American Chemical Society 138.50 (2016): 16259-16265.

Parker, J. A., et al. "Glucagon and GLP-1 inhibit food intake and increase c-fos expression in similar appetite regulating centres in the brainstem and amygdala." International journal of obesity 37.10 (2013): 1391-1398.