GLP-2 (rat)
| Name | GLP-2 (rat) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HADGSFSDEMNTILDNLATRDFINWLIQTKITD |
| Three Letter Code | {His}{Ala}{Asp}{Gly}{Ser}{Phe}{Ser}{Asp}{Glu}{Met}{Asn}{Thr}{Ile}{Leu}{Asp}{Asn}{Leu}{Ala}{Thr}{Arg}{Asp}{Phe}{Ile}{Asn}{Trp}{Leu}{Ile}{Gln}{Thr}{Lys}{Ile}{Thr}{Asp} |
| Molecular Weight | 3796.190 |
| Application | Apoptosis & NecrosisDiabetes |
| Demeure, Kevin, Valérie Gabelica, and Edwin Andre De Pauw. "New advances in the understanding of the in-source decay fragmentation of peptides in MALDI-TOF-MS." Journal of the American Society for Mass Spectrometry 21.11 (2010): 1906-1917. |
| Yusta, Bernardo, et al. "Identification of glucagon-like peptide-2 (GLP-2)-activated signaling pathways in baby hamster kidney fibroblasts expressing the rat GLP-2 receptor." Journal of Biological Chemistry 274.43 (1999): 30459-30467. |