LL - 37 (scrambled)
| Name | LL - 37 (scrambled) |
| Category | Antimicrobial and Related Peptides |
| One Letter Code | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Three Letter Code | {Gly}{Leu}{Lys}{Leu}{Arg}{Phe}{Glu}{Phe}{Ser}{Lys}{Ile}{Lys}{Gly}{Glu}{Phe}{Leu}{Lys}{Thr}{Pro}{Glu}{Val}{Arg}{Phe}{Arg}{Asp}{Ile}{Lys}{Leu}{Lys}{Asp}{Asn}{Arg}{Ile}{Ser}{Val}{Gln}{Arg} |
| Molecular Weight | 4493.300 |
| Application | Antimicrobial & Antiviral Peptides |
| Sol, Asaf, et al. "LL-37 induces polymerization and bundling of actin and affects actin structure." PLoS One 7.11 (2012). |
| Coch, Christoph, et al. "Higher activation of TLR9 in plasmacytoid dendritic cells by microbial DNA compared with self‐DNA based on CpG‐specific recognition of phosphodiester DNA." Journal of leukocyte biology 86.3 (2009): 663-670. |
| Bandholtz, L., et al. "Antimicrobial peptide LL‐37 internalized by immature human dendritic cells alters their phenotype." Scandinavian journal of immunology 63.6 (2006): 410-419. |