GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34) (human)
| Name | GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34) (human) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HADGSFSDEMNTILDNLAARDFINWLIQTKITDR |
| Three Letter Code | {His}{Ala}{Asp}{Gly}{Ser}{Phe}{Ser}{Asp}{Glu}{Met}{Asn}{Thr}{Ile}{Leu}{Asp}{Asn}{Leu}{Ala}{Ala}{Arg}{Asp}{Phe}{Ile}{Asn}{Trp}{Leu}{Ile}{Gln}{Thr}{Lys}{Ile}{Thr}{Asp}{Arg} |
| Molecular Weight | 3922.400 |
| Application | Diabetes |
| Yusta, Bernardo, et al. "Identification of glucagon-like peptide-2 (GLP-2)-activated signaling pathways in baby hamster kidney fibroblasts expressing the rat GLP-2 receptor." Journal of Biological Chemistry 274.43 (1999): 30459-30467. |
| Drucker, Daniel J. "Biological actions and therapeutic potential of the glucagon-like peptides." Gastroenterology 122.2 (2002): 531-544. |
| Koehler, J. A., B. Yusta, and D. J. Drucker. "The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways." Molecular Endocrinology 19.2 (2005): 459-473. |
| Vessey, Kirstan A., David A. Rushforth, and William K. Stell. "Glucagon-and secretin-related peptides differentially alter ocular growth and the development of form-deprivation myopia in chicks." Investigative ophthalmology & visual science 46.11 (2005): 3932-3942. |