GLP-2 (1-33) (human)
| Name | GLP-2 (1-33) (human) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | HADGSFSDEMNTILDNLAARDFINWLIQTKITD |
| Three Letter Code | {His}{Ala}{Asp}{Gly}{Ser}{Phe}{Ser}{Asp}{Glu}{Met}{Asn}{Thr}{Ile}{Leu}{Asp}{Asn}{Leu}{Ala}{Ala}{Arg}{Asp}{Phe}{Ile}{Asn}{Trp}{Leu}{Ile}{Gln}{Thr}{Lys}{Ile}{Thr}{Asp} |
| Molecular Weight | 3766.160 |
| Application | Diabetes |
| Nakame, Kazuhiko, et al. "The protective and anti-inflammatory effects of glucagon-like peptide-2 in an experimental rat model of necrotizing enterocolitis." Peptides75 (2016): 1-7. |
| Waser, Beatrice, et al. "Incretin receptors in non-neoplastic and neoplastic thyroid C cells in rodents and humans: relevance for incretin-based diabetes therapy." Neuroendocrinology 94.4 (2011): 291-301. |
| Keane, Fiona M., et al. "Neuropeptide Y, B‐type natriuretic peptide, substance P and peptide YY are novel substrates of fibroblast activation protein‐α." The FEBS journal 278.8 (2011): 1316-1332. |
| Nuche‐Berenguer, Bernardo, et al. "Presence of a functional receptor for GLP‐1 in osteoblastic cells, independent of the cAMP‐linked GLP‐1 receptor." Journal of cellular physiology 225.2 (2010): 585-592. |
| Reubi, Jean-Claude, et al. "Glucagon-like peptide-1 (GLP-1) receptors are not overexpressed in pancreatic islets from patients with severe hyperinsulinaemic hypoglycaemia following gastric bypass." Diabetologia 53.12 (2010): 2641-2645. |