GLP - 1(9 - 36), amide (human)
| Name | GLP - 1(9 - 36), amide (human) |
| Category | Glucagons and Glucagon-Like Peptides (GLP-1 and GLP-2) |
| One Letter Code | EGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Three Letter Code | {Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH2 |
| Molecular Weight | 3089.500 |
| Application | Diabetes |
| Bak, Monika Judyta, et al. "Specificity and sensitivity of commercially available assays for glucagon‐like peptide‐1 (GLP‐1): implications for GLP‐1 measurements in clinical studies." Diabetes, Obesity and Metabolism 16.11 (2014): 1155-1164. |
| Hou, Jack, et al. "Liraglutide, a long-acting GLP-1 mimetic, and its metabolite attenuate inflammation after intracerebral hemorrhage." Journal of Cerebral Blood Flow & Metabolism 32.12 (2012): 2201-2210. |
| Ma, Tao, et al. "Glucagon-like peptide-1 cleavage product GLP-1 (9-36) amide rescues synaptic plasticity and memory deficits in Alzheimer's disease model mice." Journal of Neuroscience 32.40 (2012): 13701-13708. |
| Nagashima, M., et al. "Native incretins prevent the development of atherosclerotic lesions in apolipoprotein E knockout mice." Diabetologia 54.10 (2011): 2649. |
| Hadjiyanni, I., et al. "Glucagon-like peptide-1 receptor signalling selectively regulates murine lymphocyte proliferation and maintenance of peripheral regulatory T cells." Diabetologia 53.4 (2010): 730-740. |