(Pro³)-Gastric Inhibitory Polypeptide (human)
| Name | (Pro³)-Gastric Inhibitory Polypeptide (human) |
| Category | Gastric Inhibitory Polypeptide (GIP) and Fragments |
| One Letter Code | YAPGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ |
| Three Letter Code | {Tyr}{Ala}{Pro}{Gly}{Thr}{Phe}{Ile}{Ser}{Asp}{Tyr}{Ser}{Ile}{Ala}{Met}{Asp}{Lys}{Ile}{His}{Gln}{Gln}{Asp}{Phe}{Val}{Asn}{Trp}{Leu}{Leu}{Ala}{Gln}{Lys}{Gly}{Lys}{Lys}{Asn}{Asp}{Trp}{Lys}{His}{Asn}{Ile}{Thr}{Gln} |
| Molecular Weight | 4951.600 |
| Application | Diabetes |
| Faivre, Emilie, Alison Hamilton, and Christian Hölscher. "Effects of acute and chronic administration of GIP analogues on cognition, synaptic plasticity and neurogenesis in mice." European journal of pharmacology 674.2-3 (2012): 294-306. |
| Irwin, Nigel, et al. "Early administration of the glucose-dependent insulinotropic polypeptide receptor antagonist (Pro 3) GIP prevents the development of diabetes and related metabolic abnormalities associated with genetically inherited obesity in ob/ob mice." Diabetologia 50.7 (2007): 1532-1540. |
| Gault, Victor A., et al. "Chemical ablation of gastric inhibitory polypeptide receptor action by daily (Pro3) GIP administration improves glucose tolerance and ameliorates insulin resistance and abnormalities of islet structure in obesity-related diabetes." Diabetes 54.8 (2005): 2436-2446. |
| Gault, Victor A., et al. "Characterization of the cellular and metabolic effects of a novel enzyme-resistant antagonist of glucose-dependent insulinotropic polypeptide." Biochemical and biophysical research communications 290.5 (2002): 1420-1426. |