Gastric Inhibitory Polypeptide (porcine)
| Name | Gastric Inhibitory Polypeptide (porcine) |
| Category | Gastric Inhibitory Polypeptide (GIP) and Fragments |
| One Letter Code | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHNITQ |
| Three Letter Code | {Tyr}{Ala}{Glu}{Gly}{Thr}{Phe}{Ile}{Ser}{Asp}{Tyr}{Ser}{Ile}{Ala}{Met}{Asp}{Lys}{Ile}{Arg}{Gln}{Gln}{Asp}{Phe}{Val}{Asn}{Trp}{Leu}{Leu}{Ala}{Gln}{Lys}{Gly}{Lys}{Lys}{Ser}{Asp}{Trp}{Lys}{His}{Asn}{Ile}{Thr}{Gln} |
| Molecular Weight | 4975.620 |
| Application | Diabetes |
| Fulurija, Alma, et al. "Vaccination against GIP for the treatment of obesity." PloS one 3.9 (2008). |
| Singh, Satish K., et al. "Glucose‐dependent insulinotropic polypeptide (GIP) stimulates transepithelial glucose transport." Obesity 16.11 (2008): 2412-2416. |
| Deacon, Carolyn F., et al. "GIP-(3–42) does not antagonize insulinotropic effects of GIP at physiological concentrations." American Journal of Physiology-Endocrinology and Metabolism 291.3 (2006): E468-E475. |
| Kim, Su-Jin, et al. "Glucose-dependent insulinotropic polypeptide (GIP) stimulation of pancreatic β-cell survival is dependent upon phosphatidylinositol 3-kinase (PI3K)/protein kinase B (PKB) signaling, inactivation of the forkhead transcription factor Foxo1, and down-regulation of bax expression." Journal of Biological Chemistry 280.23 (2005): 22297-22307. |