GIP (1 - 42) (human)

Description:

Gastric inhibitory polypeptide (GIP), an incretin, is an essential regulator of insulin secretion and glucose homeostasis.

Sequence:

YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

General

References

Comments (0)

Name	GIP (1 - 42) (human)
Category	Gastric Inhibitory Polypeptide (GIP) and Fragments
One Letter Code	YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Three Letter Code	{Tyr}{Ala}{Glu}{Gly}{Thr}{Phe}{Ile}{Ser}{Asp}{Tyr}{Ser}{Ile}{Ala}{Met}{Asp}{Lys}{Ile}{His}{Gln}{Gln}{Asp}{Phe}{Val}{Asn}{Trp}{Leu}{Leu}{Ala}{Gln}{Lys}{Gly}{Lys}{Lys}{Asn}{Asp}{Trp}{Lys}{His}{Asn}{Ile}{Thr}{Gln}
Molecular Weight	4983.600
Application	Diabetes

Sparre‐Ulrich, Alexander Hovard, et al. "Species‐specific action of (Pro3) GIP–a full agonist at human GIP receptors, but a partial agonist and competitive antagonist at rat and mouse GIP receptors." British journal of pharmacology 173.1 (2016): 27-38.

Berlier, J. L., et al. "Glucose-dependent insulinotropic peptide prevents serum deprivation-induced apoptosis in human bone marrow-derived mesenchymal stem cells and osteoblastic cells." Stem cell reviews and reports 11.6 (2015): 841-851.

Tatarkiewicz, K., et al. "A novel long‐acting glucose‐dependent insulinotropic peptide analogue: enhanced efficacy in normal and diabetic rodents." Diabetes, Obesity and Metabolism 16.1 (2014): 75-85.

Dirksen, Carsten, et al. "Exaggerated release and preserved insulinotropic action of glucagon-like peptide-1 underlie insulin hypersecretion in glucose-tolerant individuals after Roux-en-Y gastric bypass." Diabetologia 56.12 (2013): 2679-2687.

Hodson, David J., et al. "Lipotoxicity disrupts incretin-regulated human β cell connectivity." The Journal of clinical investigation 123.10 (2013): 4182-4194.

Timper, Katharina, et al. "Glucose-dependent insulinotropic polypeptide induces cytokine expression, lipolysis, and insulin resistance in human adipocytes." American Journal of Physiology-Endocrinology and Metabolism 304.1 (2013): E1-E13.