Galanin (human)
| Name | Galanin (human) |
| Category | Galanin and Related Peptides |
| One Letter Code | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS |
| Three Letter Code | {Gly}{Trp}{Thr}{Leu}{Asn}{Ser}{Ala}{Gly}{Tyr}{Leu}{Leu}{Gly}{Pro}{His}{Ala}{Val}{Gly}{Asn}{His}{Arg}{Ser}{Phe}{Ser}{Asp}{Lys}{Asn}{Gly}{Leu}{Thr}{Ser} |
| Molecular Weight | 3157.500 |
| Application | Alzheimer's Disease |
| Pan, Na Clara, et al. "Activation of galanin receptor 2 stimulates large conductance Ca2+-dependent K+ (BK) channels through the IP3 pathway in human embryonic kidney (HEK293) cells." Biochemical and biophysical research communications 446.1 (2014): 316-321. |
| Beazley-Long, Nicholas, et al. "VEGF-A165b is an endogenous neuroprotective splice isoform of vascular endothelial growth factor A in vivo and in vitro." The American journal of pathology 183.3 (2013): 918-929. |
| Verrier, Florence, et al. "GPCRs regulate the assembly of a multienzyme complex for purine biosynthesis." Nature chemical biology 7.12 (2011): 909. |
| Radziszewski, Piotr, et al. "Re-innervation pattern of the ‘neovagina’created from the bladder flap in patients with Mayer-Rokitanski-Kistner-Hauser syndrome: an immunochemical study." Gynecological Endocrinology 25.6 (2009): 362-371. |