Galanin-Like Peptide (porcine)
| Name | Galanin-Like Peptide (porcine) |
| Category | Galanin and Related Peptides |
| One Letter Code | APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS |
| Three Letter Code | {Ala}{Pro}{Val}{His}{Arg}{Gly}{Arg}{Gly}{Gly}{Trp}{Thr}{Leu}{Asn}{Ser}{Ala}{Gly}{Tyr}{Leu}{Leu}{Gly}{Pro}{Val}{Leu}{His}{Pro}{Pro}{Ser}{Arg}{Ala}{Glu}{Gly}{Gly}{Gly}{Lys}{Gly}{Lys}{Thr}{Ala}{Leu}{Gly}{Ile}{Leu}{Asp}{Leu}{Trp}{Lys}{Ala}{Ile}{Asp}{Gly}{Leu}{Pro}{Tyr}{Pro}{Gln}{Ser}{Gln}{Leu}{Ala}{Ser} |
| Molecular Weight | 6204.110 |
| Application |
| Kageyama, Haruaki, et al. "Anti-obesity effect of intranasal administration of galanin-like peptide (GALP) in obese mice." Scientific reports 6 (2016): 28200. |
| Seth, Asha, et al. "Effects of galanin-like peptide on food intake and the hypothalamo-pituitary-thyroid axis." Neuroendocrinology 77.2 (2003): 125-131. |
| Juréus, Anders, et al. "Galanin-like peptide (GALP) is a target for regulation by leptin in the hypothalamus of the rat." Endocrinology 141.7 (2000): 2703-2706. |
| Larm, Jari A., and Andrew L. Gundlach. "Galanin-like peptide (GALP) mRNA expression is restricted to arcuate nucleus of hypothalamus in adult male rat brain." Neuroendocrinology 72.2 (2000): 67-71. |
| Ohtaki, Tetsuya, et al. "Isolation and cDNA cloning of a novel galanin-like peptide (GALP) from porcine hypothalamus." Journal of Biological Chemistry 274.52 (1999): 37041-37045. |