Galanin-Like Peptide (human)
| Name | Galanin-Like Peptide (human) |
| Category | Galanin and Related Peptides |
| One Letter Code | APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS |
| Three Letter Code | {Ala}{Pro}{Ala}{His}{Arg}{Gly}{Arg}{Gly}{Gly}{Trp}{Thr}{Leu}{Asn}{Ser}{Ala}{Gly}{Tyr}{Leu}{Leu}{Gly}{Pro}{Val}{Leu}{His}{Leu}{Pro}{Gln}{Met}{Gly}{Asp}{Gln}{Asp}{Gly}{Lys}{Arg}{Glu}{Thr}{Ala}{Leu}{Glu}{Ile}{Leu}{Asp}{Leu}{Trp}{Lys}{Ala}{Ile}{Asp}{Gly}{Leu}{Pro}{Tyr}{Ser}{His}{Pro}{Pro}{Gln}{Pro}{Ser} |
| Molecular Weight | 6500.370 |
| Application | Obesity Research |
| Mensah, Elsie Tachie, et al. "Brain and intestinal expression of galanin-like peptide (GALP), galanin receptor R1 and galanin receptor R2, and GALP regulation of food intake in goldfish (Carassius auratus)." Neuroscience letters 637 (2017): 126-135. |
| Shioda, S., et al. "Galanin-like peptide: a key player in the homeostatic regulation of feeding and energy metabolism?." International journal of obesity 35.5 (2011): 619-628. |
| Matsumoto, Yoshio, et al. "Galanin-like peptide stimulates food intake in the rat." Neuroscience letters 322.1 (2002): 67-69. |