Echistatin

Description:

Echistatin effectively inhibits osteoclastic bone resorption in vitro and in vivo.

Sequence:

ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge: 2 - 11, 7 - 32, 8 - 37, 20 - 39)

General

References

Comments (0)

Name	Echistatin
Category	Fibronectin Fragments, RGD Peptides
One Letter Code	ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT (Disulfide bridge: 2 - 11, 7 - 32, 8 - 37, 20 - 39)
Three Letter Code	{Glu}{Cys}{Glu}{Ser}{Gly}{Pro}{Cys}{Cys}{Arg}{Asn}{Cys}{Lys}{Phe}{Leu}{Lys}{Glu}{Gly}{Thr}{Ile}{Cys}{Lys}{Arg}{Ala}{Arg}{Gly}{Asp}{Asp}{Met}{Asp}{Asp}{Tyr}{Cys}{Asn}{Gly}{Lys}{Thr}{Cys}{Asp}{Cys}{Pro}{Arg}{Asn}{Pro}{His}{Lys}{Gly}{Pro}{Ala}{Thr} (Disulfide bridge: 2-11, 7-32, 8-37, 20-39) (Disulfide bridge: 2 - 11, 7 - 32, 8 - 37, 20 - 39)
Molecular Weight	5417.120
Application	HematologyOsteoporosis Research

Mochizuki, Ayako, et al. "Cell adhesion signaling regulates RANK expression in osteoclast precursors." PLoS One 7.11 (2012).

Kumar, C. Chandra, et al. "Inhibition of angiogenesis and tumor growth by SCH221153, a dual αvβ3 and αvβ5 integrin receptor antagonist." Cancer Research 61.5 (2001): 2232-2238.