Exendin 4
| Name | Exendin 4 |
| Category | Exendins and Fragments |
| One Letter Code | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Three Letter Code | {His}{Gly}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Leu}{Ser}{Lys}{Gln}{Met}{Glu}{Glu}{Glu}{Ala}{Val}{Arg}{Leu}{Phe}{Ile}{Glu}{Trp}{Leu}{Lys}{Asn}{Gly}{Gly}{Pro}{Ser}{Ser}{Gly}{Ala}{Pro}{Pro}{Pro}{Ser}-NH2 |
| Molecular Weight | 4186.600 |
| Application | DiabetesParkinson's DiseaseVeterinary Medicine |
| Varin, E. M., et al. "Inhibition of the MAP3 kinase Tpl2 protects rodent and human β-cells from apoptosis and dysfunction induced by cytokines and enhances anti-inflammatory actions of exendin-4." Cell death & disease 7.1 (2016): e2065-e2065. |
| Rulifson, Ingrid C., et al. "Identification of human islet amyloid polypeptide as a BACE2 substrate." PloS one 11.2 (2016). |
| Jodal, Andreas, et al. "Evaluation of ¹¹¹In-Labelled Exendin-4 Derivatives Containing Different Meprin β-Specific Cleavable Linkers." PLoS One 10.4 (2015). |