(Glu⁹)-Exenatide (2-39)
| Name | (Glu⁹)-Exenatide (2-39) |
| Category | Exendins and Fragments |
| One Letter Code | GEGTFTSELSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Three Letter Code | {Gly}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Glu}{Leu}{Ser}{Lys}{Gln}{Met}{Glu}{Glu}{Glu}{Ala}{Val}{Arg}{Leu}{Phe}{Ile}{Glu}{Trp}{Leu}{Lys}{Asn}{Gly}{Gly}{Pro}{Ser}{Ser}{Gly}{Ala}{Pro}{Pro}{Pro}{Ser}-NH₂ |
| Molecular Weight | 4063.520 |
| Application | Diabetes |
| Williams, Diana L., Denis G. Baskin, and Michael W. Schwartz. "Evidence that intestinal glucagon-like peptide-1 plays a physiological role in satiety." Endocrinology 150.4 (2009): 1680-1687. |
| Sandoval, Darleen A., et al. "Arcuate glucagon-like peptide 1 receptors regulate glucose homeostasis but not food intake." Diabetes 57.8 (2008): 2046-2054. |
| Seeley, Randy J., et al. "The role of CNS glucagon-like peptide-1 (7-36) amide receptors in mediating the visceral illness effects of lithium chloride." Journal of Neuroscience 20.4 (2000): 1616-1621. |