Exendin (9 - 39)
| Name | Exendin (9 - 39) |
| Category | Exendins and Fragments |
| One Letter Code | DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Three Letter Code | {Asp}{Leu}{Ser}{Lys}{Gln}{Met}{Glu}{Glu}{Glu}{Ala}{Val}{Arg}{Leu}{Phe}{Ile}{Glu}{Trp}{Leu}{Lys}{Asn}{Gly}{Gly}{Pro}{Ser}{Ser}{Gly}{Ala}{Pro}{Pro}{Pro}{Ser}-NH2 |
| Molecular Weight | 3369.800 |
| Application | Diabetes |
| Svane, M. S., et al. "Peptide YY and glucagon-like peptide-1 contribute to decreased food intake after Roux-en-Y gastric bypass surgery." International Journal of Obesity 40.11 (2016): 1699-1706. |
| Ramracheya, Reshma D., et al. "PYY-dependent restoration of impaired insulin and glucagon secretion in type 2 diabetes following Roux-En-Y gastric bypass surgery." Cell reports 15.5 (2016): 944-950. |
| Dods, Rachel L., and Dan Donnelly. "The peptide agonist-binding site of the glucagon-like peptide-1 (GLP-1) receptor based on site-directed mutagenesis and knowledge-based modelling." Bioscience reports 36.1 (2016). |
| Alhadeff, Amber L., et al. "Glucagon-like peptide-1 receptor signaling in the lateral parabrachial nucleus contributes to the control of food intake and motivation to feed." Neuropsychopharmacology 39.9 (2014): 2233-2243. |
| West, Graham M., et al. "Glucagon-like peptide-1 receptor ligand interactions: structural cross talk between ligands and the extracellular domain." PloS one 9.9 (2014). |
| Imoto, Hirofumi, et al. "Effects of duodeno-jejunal bypass on glucose metabolism in obese rats with type 2 diabetes." Surgery today 44.2 (2014): 340-348. |