Exendin (9 - 39)

Description:

Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist.

Sequence:

DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
  • General
  • References
  • Comments (0)
  • Name Exendin (9 - 39)
    Category Exendins and Fragments
    One Letter Code DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
    Three Letter Code {Asp}{Leu}{Ser}{Lys}{Gln}{Met}{Glu}{Glu}{Glu}{Ala}{Val}{Arg}{Leu}{Phe}{Ile}{Glu}{Trp}{Leu}{Lys}{Asn}{Gly}{Gly}{Pro}{Ser}{Ser}{Gly}{Ala}{Pro}{Pro}{Pro}{Ser}-NH2
    Molecular Weight 3369.800
    Application Diabetes
    Svane, M. S., et al. "Peptide YY and glucagon-like peptide-1 contribute to decreased food intake after Roux-en-Y gastric bypass surgery." International Journal of Obesity 40.11 (2016): 1699-1706.
    Ramracheya, Reshma D., et al. "PYY-dependent restoration of impaired insulin and glucagon secretion in type 2 diabetes following Roux-En-Y gastric bypass surgery." Cell reports 15.5 (2016): 944-950.
    Dods, Rachel L., and Dan Donnelly. "The peptide agonist-binding site of the glucagon-like peptide-1 (GLP-1) receptor based on site-directed mutagenesis and knowledge-based modelling." Bioscience reports 36.1 (2016).
    Alhadeff, Amber L., et al. "Glucagon-like peptide-1 receptor signaling in the lateral parabrachial nucleus contributes to the control of food intake and motivation to feed." Neuropsychopharmacology 39.9 (2014): 2233-2243.
    West, Graham M., et al. "Glucagon-like peptide-1 receptor ligand interactions: structural cross talk between ligands and the extracellular domain." PloS one 9.9 (2014).
    Imoto, Hirofumi, et al. "Effects of duodeno-jejunal bypass on glucose metabolism in obese rats with type 2 diabetes." Surgery today 44.2 (2014): 340-348.
    #[first_name]
    #[create_date]
    #[comment]
    Reply(#[reply_num])
    #[like_num]
  • #[first_name]
    #[create_date]
    #[comment]
    Reply
    #[like_num]