Big Endothelin-1 (rat)
| Name | Big Endothelin-1 (rat) |
| Category | Endothelins and Related Peptides |
| One Letter Code | CSCSSLMDKECVYFCHLDIIWVNTPERVVPYGLGSPSRS (Disulfide bridge: 1 - 15, 3 - 11) |
| Three Letter Code | {Cys}{Ser}{Cys}{Ser}{Ser}{Leu}{Met}{Asp}{Lys}{Glu}{Cys}{Val}{Tyr}{Phe}{Cys}{His}{Leu}{Asp}{Ile}{Ile}{Trp}{Val}{Asn}{Thr}{Pro}{Glu}{Arg}{Val}{Val}{Pro}{Tyr}{Gly}{Leu}{Gly}{Ser}{Pro}{Ser}{Arg}{Ser} (Disulfide bridge: 1-15, 3-11) (Disulfide bridge: 1 - 15, 3 - 11) |
| Molecular Weight | 4389.060 |
| Application | Cardiovascular System & Diseases |
| Sakurai, Takeshi, et al. "cDNA cloning, sequence analysis and tissue distribution of rat preproendothelin-1 mRNA." Biochemical and biophysical research communications 175.1 (1991): 44-47. |