Big Endothelin - 1 (1 - 38) (human)
| Name | Big Endothelin - 1 (1 - 38) (human) |
| Category | Endothelins and Related Peptides |
| One Letter Code | CSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRS (Disulfide bridge: 1 - 15, 3 - 11) |
| Three Letter Code | {Cys}{Ser}{Cys}{Ser}{Ser}{Leu}{Met}{Asp}{Lys}{Glu}{Cys}{Val}{Tyr}{Phe}{Cys}{His}{Leu}{Asp}{Ile}{Ile}{Trp}{Val}{Asn}{Thr}{Pro}{Glu}{His}{Val}{Val}{Pro}{Tyr}{Gly}{Leu}{Gly}{Ser}{Pro}{Arg}{Ser} (Disulfide bridge: 1-15, 3-11) (Disulfide bridge: 1 - 15, 3 - 11) |
| Molecular Weight | 4283.000 |
| Application | Cardiovascular System & Diseases |
| Fecteau, Marie-Hélène, et al. "Endothelin-1 (1-31) is an intermediate in the production of endothelin-1 after big endothelin-1 administration in vivo." Hypertension 46.1 (2005): 87-92. |
| Gurusankar, Roma, et al. "Correlation between saliva and plasma levels of endothelin isoforms ET-1, ET-2, and ET-3." International journal of peptides 2015 (2015). |
| Kumarathasan, P., et al. "Applicability of a high-throughput shotgun plasma protein screening approach in understanding maternal biological pathways relevant to infant birth weight outcome." Journal of proteomics 100 (2014): 136-146. |
| Karthikeyan, Subramanian, Premkumari Kumarathasan, and Renaud Vincent. "Data mining of plasma peptide chromatograms for biomarkers of air contaminant exposures." Proteome science 6.1 (2008): 6. |
| Abdel-Sayed, Saad, et al. "Measurement of plasma endothelin-1 in experimental hypertension and in healthy subjects." American journal of hypertension 16.7 (2003): 515-521. |