Big Endothelin 1 (1 - 39) (porcine)

Description:

This is a 38 residue inactive big endothelin-1 intermediate that gives rise to a shorter active peptide produced in vascular endothelial cells.

Sequence:

CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS

General

References

Comments (0)

Name	Big Endothelin 1 (1 - 39) (porcine)
Category	Endothelins and Related Peptides
One Letter Code	CSCSSLMDKECVYFCHLDIIWVNTPEHIVPYGLGSPSRS
Three Letter Code	{Cys}{Ser}{Cys}{Ser}{Ser}{Leu}{Met}{Asp}{Lys}{Glu}{Cys}{Val}{Tyr}{Phe}{Cys}{His}{Leu}{Asp}{Ile}{Ile}{Trp}{Val}{Asn}{Thr}{Pro}{Glu}{His}{Ile}{Val}{Pro}{Tyr}{Gly}{Leu}{Gly}{Ser}{Pro}{Ser}{Arg}{Ser}
Molecular Weight	4384.100
Application	Cardiovascular System & Diseases

Xu, Dong, et al. "ECE-1: a membrane-bound metalloprotease that catalyzes the proteolytic activation of big endothelin-1." Cell 78.3 (1994): 473-485.

Kimura, Sadao, et al. "Conversion of big endothelin-1 to 21-residue endothelin-1 is essential for expression of full vasoconstrictor activity: structure-activity relationships of big endothelin-1." Journal of cardiovascular pharmacology 13 (1989): S5-7.

Kashiwabara, Tomoko, et al. "Putative precursors of endothelin have less vasoconstrictor activity in vitro but a potent pressor effect in vivo." FEBS letters 247.1 (1989): 73-76.

Yanagisawa, Masashi, et al. "A novel potent vasoconstrictor peptide produced by vascular endothelial cells." nature 332.6163 (1988): 411-415.

Itoh, Y., et al. "lshida N, Mitsui Y, Onda H, Fujino M, Masaki T: Cloning and sequence analysis of cDNA encoding the precursor of a human endothelium-derived vasoconstrictor peptide, endothelin: Identity of human and porcine endothelin." FEBS Lett 231 (1988): 440-444.