Calcitonin (human)

Description:

Human calcitonin stimulates cyclic nucleotide accumulation in human kidney cortex and medulla. Calcitonin maybe involved in osteoporosis and in Paget's disease.

Sequence:

CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)

General

References

Comments (0)

Name	Calcitonin (human)
Category	Disulfide Cyclized Peptides
One Letter Code	CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP-NH2 (Disulfide bridge: 1-7)
Three Letter Code	{Cys}{Gly}{Asn}{Leu}{Ser}{Thr}{Cys}{Met}{Leu}{Gly}{Thr}{Tyr}{Thr}{Gln}{Asp}{Phe}{Asn}{Lys}{Phe}{His}{Thr}{Phe}{Pro}{Gln}{Thr}{Ala}{Ile}{Gly}{Val}{Gly}{Ala}{Pro}-NH2 (Disulfide bridge: 1-7) (Disulfide bridge: 1-7)
Molecular Weight	3417.900
Application

Raddino, R., et al. "Mechanism of action of human calcitonin gene-related peptide in rabbit heart and in human mammary arteries." Journal of cardiovascular pharmacology 29.4 (1997): 463-470.

Rotella, Carlo M., Maria Luisa Brandi, and Roberto S. Toccafondi. "Human calcitonin increases both cyclic AMP and cyclic GMP accumulation in human kidney cells." European journal of pharmacology 107.3 (1985): 347-352.

Moriarty, Daniel F., Susan Vagts, and Daniel P. Raleigh. "A role for the C-terminus of calcitonin in aggregation and gel formation: a comparative study of C-terminal fragments of human and salmon calcitonin." Biochemical and biophysical research communications 245.2 (1998): 344-348.

Chen, Wen-Ji, et al. "Expression cloning and receptor pharmacology of human calcitonin receptors from MCF-7 cells and their relationship to amylin receptors." Molecular pharmacology 52.6 (1997): 1164-1175.