hBD - 3, β - Defensin - 3 (human)
| Name | hBD - 3, β - Defensin - 3 (human) |
| Category | Defensins |
| One Letter Code | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41) |
| Three Letter Code | {Gly}{Ile}{Ile}{Asn}{Thr}{Leu}{Gln}{Lys}{Tyr}{Tyr}{Cys}{Arg}{Val}{Arg}{Gly}{Gly}{Arg}{Cys}{Ala}{Val}{Leu}{Ser}{Cys}{Leu}{Pro}{Lys}{Glu}{Glu}{Gln}{Ile}{Gly}{Lys}{Cys}{Ser}{Thr}{Arg}{Gly}{Arg}{Lys}{Cys}{Cys}{Arg}{Arg}{Lys}{Lys} (Disulfide bridge: 11-40, 18-33, 23-41) (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41) |
| Molecular Weight | 5155.200 |
| Application |
| Niyonsaba, François, and Hideoki Ogawa. "Protective roles of the skin against infection: implication of naturally occurring human antimicrobial agents β-defensins, cathelicidin LL-37 and lysozyme." Journal of dermatological science 40.3 (2005): 157-168. |
| Dhople, Vishnu, Amy Krukemeyer, and Ayyalusamy Ramamoorthy. "The human beta-defensin-3, an antibacterial peptide with multiple biological functions." Biochimica et Biophysica Acta (BBA)-Biomembranes 1758.9 (2006): 1499-1512. |
| Cole, Alexander M. "Antimicrobial peptide microbicides targeting HIV." Protein and peptide letters 12.1 (2005): 41-47. |