hBD - 1, β - Defensin - 1 (human)

Description:

BD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli. Moreover hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells

Sequence:

DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)

General

References

Comments (0)

Name	hBD - 1, β - Defensin - 1 (human)
Category	Defensins
One Letter Code	DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Three Letter Code	{Asp}{His}{Tyr}{Asn}{Cys}{Val}{Ser}{Ser}{Gly}{Gly}{Gln}{Cys}{Leu}{Tyr}{Ser}{Ala}{Cys}{Pro}{Ile}{Phe}{Thr}{Lys}{Ile}{Gln}{Gly}{Thr}{Cys}{Tyr}{Arg}{Gly}{Lys}{Ala}{Lys}{Cys}{Cys}{Lys} (Disulfide bridge: 5-34, 12-27, 17-35) (Disulfide bridge: 5 - 34, 12 - 27, 17 - 35)
Molecular Weight	3929.600
Application

Niyonsaba, François, and Hideoki Ogawa. "Protective roles of the skin against infection: implication of naturally occurring human antimicrobial agents β-defensins, cathelicidin LL-37 and lysozyme." Journal of dermatological science 40.3 (2005): 157-168.