HNP - 1, Defensin Human Neutrophil Peptide - 1

Description:

Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities.

Sequence:

ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)

General

References

Comments (0)

Name	HNP - 1, Defensin Human Neutrophil Peptide - 1
Category	Defensins
One Letter Code	ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Three Letter Code	{Ala}{Cys}{Tyr}{Cys}{Arg}{Ile}{Pro}{Ala}{Cys}{Ile}{Ala}{Gly}{Glu}{Arg}{Arg}{Tyr}{Gly}{Thr}{Cys}{Ile}{Tyr}{Gln}{Gly}{Arg}{Leu}{Trp}{Ala}{Phe}{Cys}{Cys} (Disulfide bridge: 2-30, 4-19, 9-29) (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Molecular Weight	3442.100
Application

Frick, Inga-Maria, et al. "SIC, a Secreted Protein of Streptococcus pyogenesThat Inactivates Antibacterial Peptides." Journal of Biological Chemistry 278.19 (2003): 16561-16566.

Mizukawa, Nobuyoshi, et al. "Immunohistochemical staining of human alpha-defensin-1 (HNP-1), in the submandibular glands of patients with oral carcinomas." Anticancer research 20.2B (2000): 1125-1127.

Bastian, Andreas, and Heiner Schäfer. "Human α-defensin 1 (HNP-1) inhibits adenoviral infection in vitro." Regulatory peptides 101.1-3 (2001): 157-161.