Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
| Name | Anti - BetaGamma (MPS - Phosducin - like protein C terminus) |
| Category | Cell Permeable Peptides (CPP) / Drug Delivery Peptides |
| One Letter Code | AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE |
| Three Letter Code | {Ala}{Ala}{Val}{Ala}{Leu}{Leu}{Pro}{Ala}{Val}{Leu}{Leu}{Ala}{Leu}{Leu}{Ala}{Val}{Thr}{Asp}{Gln}{Leu}{Gly}{Glu}{Asp}{Phe}{Phe}{Ala}{Val}{Asp}{Leu}{Glu}{Ala}{Phe}{Leu}{Gln}{Glu}{Phe}{Gly}{Leu}{Leu}{Pro}{Glu}{Lys}{Glu} |
| Molecular Weight | 4601.400 |
| Application | Cell-permeable Peptides |
| Orr, Anthony Wayne, Manuel Antonio Pallero, and Joanne E. Murphy-Ullrich. "Thrombospondin stimulates focal adhesion disassembly through Gi-and phosphoinositide 3-kinase-dependent ERK activation." Journal of Biological Chemistry 277.23 (2002): 20453-20460. |
| Chang, Mike, et al. "Dissecting G Protein-coupled Receptor Signaling Pathways with Membrane-permeable Blocking Peptides ENDOGENOUS 5-HT2C RECEPTORS IN CHOROID PLEXUS EPITHELIAL CELLS." Journal of Biological Chemistry 275.10 (2000): 7021-7029. |