Amylin (1 - 37) (human) amide
| Name | Amylin (1 - 37) (human) amide |
| Category | Amylin (IAPP) and Fragments |
| One Letter Code | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: 2-7) |
| Three Letter Code | {Lys}{Cys}{Asn}{Thr}{Ala}{Thr}{Cys}{Ala}{Thr}{Gln}{Arg}{Leu}{Ala}{Asn}{Phe}{Leu}{Val}{His}{Ser}{Ser}{Asn}{Asn}{Phe}{Gly}{Ala}{Ile}{Leu}{Ser}{Ser}{Thr}{Asn}{Val}{Gly}{Ser}{Asn}{Thr}{Tyr}-NH2 (Disulfide bridge: 2-7) (Disulfide bridge: 2-7) |
| Molecular Weight | 3903.300 |
| Application | Diabetes |
| Schultz, Nina, et al. "Amylin alters human brain pericyte viability and NG2 expression." Journal of Cerebral Blood Flow & Metabolism 37.4 (2017): 1470-1482. |
| Okada, Alan K., et al. "Diabetic risk factors promote islet amyloid polypeptide misfolding by a common, membrane-mediated mechanism." Scientific reports 6.1 (2016): 1-10. |
| Vasconcelos, Bruno, et al. "Heterotypic seeding of Tau fibrillization by pre-aggregated Abeta provides potent seeds for prion-like seeding and propagation of Tau-pathology in vivo." Acta neuropathologica 131.4 (2016): 549-569. |
| Sciacca, Michele FM, et al. "The role of cholesterol in driving IAPP-membrane interactions." Biophysical journal 111.1 (2016): 140-151. |
| Sisnande, Tháyna, et al. "Monoconjugation of human amylin with methylpolyethyleneglycol." PloS one 10.10 (2015). |
| Bram, Yaron, et al. "Monitoring and targeting the initial dimerization stage of amyloid self‐assembly." Angewandte Chemie International Edition 54.7 (2015): 2062-2067. |