Calcitonin (salmon I)

Description:

Salmon calcitonin (sCT) is more potent than the human analog. Calcitonin inhibits osteoclast activity, lowers the blood calcium level, and positively influences bone mass density.

Sequence:

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH₂ (Disulfide bridge: 1-7)

General

References

Comments (0)

Name	Calcitonin (salmon I)
Category	Calcitonin Gene-Related Peptide (CGRP) and Fragments
One Letter Code	CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH₂ (Disulfide bridge: 1-7)
Three Letter Code	{Cys}{Ser}{Asn}{Leu}{Ser}{Thr}{Cys}{Val}{Leu}{Gly}{Lys}{Leu}{Ser}{Gln}{Glu}{Leu}{His}{Lys}{Leu}{Gln}{Thr}{Tyr}{Pro}{Arg}{Thr}{Asn}{Thr}{Gly}{Ser}{Gly}{Thr}{Pro}-NH₂ (Disulfide bridge: 1-7) (Disulfide bridge: 1-7)
Molecular Weight	3431.900
Application	Osteoporosis Research

Oh, Dong-Ho, et al. "Strategic approaches for enhancement of in vivo transbuccal peptide drug delivery in rabbits using iontophoresis and chemical enhancers." Pharmaceutical research 32.3 (2015): 929-940.

Braegger, Fiona E., et al. "The role of the area postrema in the anorectic effects of amylin and salmon calcitonin: behavioral and neuronal phenotyping." European Journal of Neuroscience 40.7 (2014): 3055-3066.

Andreassen, Kim Vietz, et al. "Prolonged calcitonin receptor signaling by salmon, but not human calcitonin, reveals ligand bias." PloS one 9.3 (2014).

Andreassen, Kim V., et al. "A novel oral dual amylin and calcitonin receptor agonist (KBP-042) exerts antiobesity and antidiabetic effects in rats." American Journal of Physiology-Endocrinology and Metabolism 307.1 (2014): E24-E33.

Sinsuebpol, Chutima, Jittima Chatchawalsaisin, and Poj Kulvanich. "Preparation and in vivo absorption evaluation of spray dried powders containing salmon calcitonin loaded chitosan nanoparticles for pulmonary delivery." Drug design, development and therapy 7 (2013): 861.

Bronsema, Kees J., Rainer Bischoff, and Nico C. van de Merbel. "High-sensitivity LC-MS/MS quantification of peptides and proteins in complex biological samples: the impact of enzymatic digestion and internal standard selection on method performance." Analytical chemistry 85.20 (2013): 9528-9535.