Beta - Amyloid (40 - 1)

Description:

The reverse sequence of Aβ 1-40 is used as inactive control.

Sequence:

VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

General

References

Comments (0)

Name	Beta - Amyloid (40 - 1)
Category	Beta-Amyloidand Related Peptides
One Letter Code	VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Three Letter Code	{Val}{Val}{Gly}{Gly}{Val}{Met}{Leu}{Gly}{Ile}{Ile}{Ala}{Gly}{Lys}{Asn}{Ser}{Gly}{Val}{Asp}{Glu}{Ala}{Phe}{Phe}{Val}{Leu}{Lys}{Gln}{His}{His}{Val}{Glu}{Tyr}{Gly}{Ser}{Asp}{His}{Arg}{Phe}{Glu}{Ala}{Asp}
Molecular Weight	4329.900
Application	Alzheimer's Disease

Mita, Tsuneyuki, et al. "Conditioned medium from the stem cells of human dental pulp improves cognitive function in a mouse model of Alzheimer’s disease." Behavioural Brain Research 293 (2015): 189-197.

Maloney, Bryan, and Debomoy K. Lahiri. "The Alzheimer's amyloid β-peptide (Aβ) binds a specific DNA Aβ-interacting domain (AβID) in the APP, BACE1, and APOE promoters in a sequence-specific manner: characterizing a new regulatory motif." Gene 488.1-2 (2011): 1-12.

Bailey, Jason A., et al. "Functional activity of the novel Alzheimer's amyloid β-peptide interacting domain (AβID) in the APP and BACE1 promoter sequences and implications in activating apoptotic genes and in amyloidogenesis." Gene 488.1-2 (2011): 13-22.

Colom, Luis V., et al. "Medial septal β-amyloid 1-40 injections alter septo-hippocampal anatomy and function." Neurobiology of aging 31.1 (2010): 46-57.

Casley, Christopher S., et al. "Up-regulation of astrocyte metabotropic glutamate receptor 5 by amyloid-β peptide." Brain research 1260 (2009): 65-75.

Kerrigan, Talitha L., et al. "Modulation of ‘A’-type K+ current by rodent and human forms of amyloid β protein." Neuroreport 19.8 (2008): 839-843.