Amylin (8 - 37) (rat)
| Name | Amylin (8 - 37) (rat) |
| Category | Amylin (IAPP) and Fragments |
| One Letter Code | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| Three Letter Code | {Ala}{Thr}{Gln}{Arg}{Leu}{Ala}{Asn}{Phe}{Leu}{Val}{Arg}{Ser}{Ser}{Asn}{Asn}{Leu}{Gly}{Pro}{Val}{Leu}{Pro}{Pro}{Thr}{Asn}{Val}{Gly}{Ser}{Asn}{Thr}{Tyr}-NH2 |
| Molecular Weight | 3200.600 |
| Application | Diabetes |
| Milton, Nathaniel GN, and J. Robin Harris. "Polymorphism of amyloid fibrils and their complexes with catalase." Bio-nanoimaging. Academic Press, 2014. 255-262. |
| Bailey, R. J., et al. "Pharmacological characterization of rat amylin receptors: implications for the identification of amylin receptor subtypes." British journal of pharmacology 166.1 (2012): 151-167. |
| Hay, Debbie L., et al. "Pharmacological discrimination of calcitonin receptor: receptor activity-modifying protein complexes." Molecular pharmacology 67.5 (2005): 1655-1665. |
| Piao, Feng Lian, et al. "Dendroaspis natriuretic peptide and its functions in pig ovarian granulosa cells." Regulatory peptides 118.3 (2004): 193-198. |