Beta - Amyloid (4 - 42)
| Name | Beta - Amyloid (4 - 42) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Three Letter Code | {Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Molecular Weight | 4198.800 |
| Application | Alzheimer's Disease |
| Antonios, Gregory, et al. "N-truncated Abeta starting with position four: early intraneuronal accumulation and rescue of toxicity using NT4X-167, a novel monoclonal antibody." Acta neuropathologica communications 1.1 (2013): 56. |
| Bouter, Yvonne, et al. "N-truncated amyloid β (Aβ) 4-42 forms stable aggregates and induces acute and long-lasting behavioral deficits." Acta neuropathologica 126.2 (2013): 189-205. |
| Portelius, Erik, et al. "Mass spectrometric characterization of brain amyloid beta isoform signatures in familial and sporadic Alzheimer’s disease." Acta neuropathologica 120.2 (2010): 185-193. |
| Tomidokoro, Yasushi, et al. "Familial Danish dementia co-existence of Danish and Alzheimer amyloid subunits (ADan and Aβ) in the absence of compact plaques." Journal of Biological Chemistry 280.44 (2005): 36883-36894. |