Beta - Amyloid (11 - 40)
| Name | Beta - Amyloid (11 - 40) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 3151.700 |
| Application | Alzheimer's Disease |
| Tjernberg, Lars O., et al. "A molecular model of Alzheimer amyloid β-peptide fibril formation." Journal of Biological Chemistry 274.18 (1999): 12619-12625. |
| Qahwash, Isam, et al. "Processing amyloid precursor protein at the β-site requires proper orientation to be accessed by BACE1." Journal of Biological Chemistry 279.37 (2004): 39010-39016. |
| Liu, Kangning, Robert W. Doms, and Virginia M-Y. Lee. "Glu11 site cleavage and N-terminally truncated Aβ production upon BACE overexpression." Biochemistry 41.9 (2002): 3128-3136. |