(Val²)-Amyloid β-Protein (1-42)
| Name | (Val²)-Amyloid β-Protein (1-42) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DVEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Three Letter Code | {Asp}{Val}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Molecular Weight | 4542.160 |
| Application | Alzheimer's Disease |
| Colombo, Laura, et al. "Pathogenic Aβ A2V versus protective Aβ A2T mutation: Early stage aggregation and membrane interaction." Biophysical chemistry 229 (2017): 11-18. |
| Quast, Robert B., et al. "High-yield cell-free synthesis of human EGFR by IRES-mediated protein translation in a continuous exchange cell-free reaction format." Scientific reports 6.1 (2016): 1-10. |
| Messa, Massimo, et al. "The peculiar role of the A2V mutation in amyloid-β (Aβ) 1–42 molecular assembly." Journal of Biological Chemistry 289.35 (2014): 24143-24152. |