(Thr²)-Amyloid β-Protein (1-42)
| Name | (Thr²)-Amyloid β-Protein (1-42) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DTEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Three Letter Code | {Asp}{Thr}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala} |
| Molecular Weight | 4544.130 |
| Application | Alzheimer's Disease |
| Colombo, Laura, et al. "Pathogenic Aβ A2V versus protective Aβ A2T mutation: Early stage aggregation and membrane interaction." Biophysical chemistry 229 (2017): 11-18. |
| Das, Payel, Anita R. Chacko, and Georges Belfort. "Alzheimer’s protective cross-interaction between wild-type and A2T variants alters Aβ42 dimer structure." ACS chemical neuroscience 8.3 (2017): 606-618. |
| Kokawa, Asuka, et al. "The A673T mutation in the amyloid precursor protein reduces the production of β-amyloid protein from its β-carboxyl terminal fragment in cells." Acta neuropathologica communications 3.1 (2015): 66. |
| Messa, Massimo, et al. "The peculiar role of the A2V mutation in amyloid-β (Aβ) 1–42 molecular assembly." Journal of Biological Chemistry 289.35 (2014): 24143-24152. |