[Asn7] - beta - Amyloid (1 - 40), Tottori - Japanese Mutation
| Name | [Asn7] - beta - Amyloid (1 - 40), Tottori - Japanese Mutation |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asn}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4328.900 |
| Application | Alzheimer's Disease |
| Viet, Man Hoang, et al. "Effect of the Tottori Familial Disease Mutation (D7N) on the Monomers and Dimers of Aβ40 and Aβ42." ACS chemical neuroscience 4.11 (2013): 1446-1457. |
| Alies, Bruno, et al. "pH-Dependent Cu (II) coordination to amyloid-β peptide: impact of sequence alterations, including the H6R and D7N familial mutations." Inorganic chemistry 50.21 (2011): 11192-11201. |
| Ono, Kenjiro, Margaret M. Condron, and David B. Teplow. "Effects of the English (H6R) and Tottori (D7N) familial Alzheimer disease mutations on amyloid β-protein assembly and toxicity." Journal of Biological Chemistry 285.30 (2010): 23186-23197. |
| Hori, Yukiko, et al. "The Tottori (D7N) and English (H6R) familial Alzheimer disease mutations accelerate Aβ fibril formation without increasing protofibril formation." Journal of biological chemistry 282.7 (2007): 4916-4923. |
| Wakutani, Y., et al. "Novel amyloid precursor protein gene missense mutation (D678N) in probable familial Alzheimer’s disease." Journal of Neurology, Neurosurgery & Psychiatry 75.7 (2004): 1039-1042. |