[Asn7] - beta - Amyloid (1 - 40), Tottori - Japanese Mutation

Description:

This peptide is the mutant form of the Aβ 1-40. It accelerates fibrillation without increasing protofibril formation.

Sequence:

DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
  • General
  • References
  • Comments (0)
  • Name [Asn7] - beta - Amyloid (1 - 40), Tottori - Japanese Mutation
    Category Beta-Amyloidand Related Peptides
    One Letter Code DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
    Three Letter Code {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asn}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
    Molecular Weight 4328.900
    Application Alzheimer's Disease
    Viet, Man Hoang, et al. "Effect of the Tottori Familial Disease Mutation (D7N) on the Monomers and Dimers of Aβ40 and Aβ42." ACS chemical neuroscience 4.11 (2013): 1446-1457.
    Alies, Bruno, et al. "pH-Dependent Cu (II) coordination to amyloid-β peptide: impact of sequence alterations, including the H6R and D7N familial mutations." Inorganic chemistry 50.21 (2011): 11192-11201.
    Ono, Kenjiro, Margaret M. Condron, and David B. Teplow. "Effects of the English (H6R) and Tottori (D7N) familial Alzheimer disease mutations on amyloid β-protein assembly and toxicity." Journal of Biological Chemistry 285.30 (2010): 23186-23197.
    Hori, Yukiko, et al. "The Tottori (D7N) and English (H6R) familial Alzheimer disease mutations accelerate Aβ fibril formation without increasing protofibril formation." Journal of biological chemistry 282.7 (2007): 4916-4923.
    Wakutani, Y., et al. "Novel amyloid precursor protein gene missense mutation (D678N) in probable familial Alzheimer’s disease." Journal of Neurology, Neurosurgery & Psychiatry 75.7 (2004): 1039-1042.
    #[first_name]
    #[create_date]
    #[comment]
    Reply(#[reply_num])
    #[like_num]
  • #[first_name]
    #[create_date]
    #[comment]
    Reply
    #[like_num]