(Arg¹³)-Amyloid β-Protein (1-40)
| Name | (Arg¹³)-Amyloid β-Protein (1-40) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{Arg}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4348.910 |
| Application | Alzheimer's Disease |
| Poduslo, Joseph F., et al. "HH domain of Alzheimer’s disease Aβ provides structural basis for neuronal binding in PC12 and mouse cortical/hippocampal neurons." PLoS One 5.1 (2010). |
| Dai, Xueling, et al. "Copper enhances amyloid-β peptide neurotoxicity and non β-aggregation: a series of experiments conducted upon copper-bound and copper-free amyloid-β peptide." Journal of molecular neuroscience 41.1 (2010): 66-73. |
| Smith, David P., et al. "Copper-mediated amyloid-β toxicity is associated with an intermolecular histidine bridge." Journal of Biological Chemistry 281.22 (2006): 15145-15154. |