[Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation
| Name | [Gln22, Asn23] - beta - Amyloid (1 - 40), E22Q/D23N Dutch/Iowa double mutation |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gln}{Asn}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4327.900 |
| Application | Alzheimer's Disease |
| Xu, Feng, et al. "Human apolipoprotein E redistributes fibrillar amyloid deposition in Tg-SwDI mice." Journal of Neuroscience 28.20 (2008): 5312-5320. |
| Xu, Feng, et al. "Early-onset subicular microvascular amyloid and neuroinflammation correlate with behavioral deficits in vasculotropic mutant amyloid β-protein precursor transgenic mice." Neuroscience 146.1 (2007): 98-107. |
| Hoos, Michael D., et al. "Inhibition of familial cerebral amyloid angiopathy mutant amyloid β-protein fibril assembly by myelin basic protein." Journal of Biological Chemistry 282.13 (2007): 9952-9961. |
| Fan, Rong, et al. "Minocycline reduces microglial activation and improves behavioral deficits in a transgenic model of cerebral microvascular amyloid." Journal of Neuroscience 27.12 (2007): 3057-3063. |