[Gln22] - beta - Amyloid (1 - 42), E22Q Dutch Mutation

Description:

This is amino acids 1 to 42 fragment of the beta-amyloid peptide with Glu replaced by Gln at position 22.The E22Q 'Dutch' mutant, also known as HCHWA-D, is a naturally occurring mutant form of the wild type (WT) beta-Amyloid 1 to 42 peptide.

Sequence:

DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA

General

References

Comments (0)

Name	[Gln22] - beta - Amyloid (1 - 42), E22Q Dutch Mutation
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVVIA
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gln}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala}
Molecular Weight	4513.100
Application	Alzheimer's Disease

Muñoz, Francisco J., et al. "Vitamin E but not 17β-estradiol protects against vascular toxicity induced by β-amyloid wild type and the Dutch amyloid variant." Journal of Neuroscience 22.8 (2002): 3081-3089.

Davis, Judianne, et al. "Early-onset and robust cerebral microvascular accumulation of amyloid β-protein in transgenic mice expressing low levels of a vasculotropic Dutch/Iowa mutant form of amyloid β-protein precursor." Journal of Biological Chemistry 279.19 (2004): 20296-20306.

Panda, Pritam Kumar, et al. "Genetics of PCOS: a systematic bioinformatics approach to unveil the proteins responsible for PCOS." Genomics data 8 (2016): 52-60.

Kassler, Kristin, Anselm HC Horn, and Heinrich Sticht. "Effect of pathogenic mutations on the structure and dynamics of Alzheimer’s Aβ 42-amyloid oligomers." Journal of molecular modeling 16.5 (2010): 1011-1020.

Dahlgren, Karie N., et al. "Oligomeric and fibrillar species of amyloid-β peptides differentially affect neuronal viability." Journal of Biological Chemistry 277.35 (2002): 32046-32053.