[Gln22] - beta - Amyloid (1 - 40), Dutch Mutation

Description:

The Dutch mutation (E22Q) of amyloid β-peptide aggregates more readily than the wild-type peptide and the resulting fibrils show increased neurotoxicity.

Sequence:

DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV

General

References

Comments (0)

Name	[Gln22] - beta - Amyloid (1 - 40), Dutch Mutation
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAQDVGSNKGAIIGLMVGGVV
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gln}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
Molecular Weight	4328.900
Application	Alzheimer's Disease

Jan, Asad, Dean M. Hartley, and Hilal A. Lashuel. "Preparation and characterization of toxic Aβ aggregates for structural and functional studies in Alzheimer's disease research." Nature protocols 5.6 (2010): 1186.

Solito, Raffaella, et al. "Dutch and arctic mutant peptides of β amyloid1–40 differentially affect the FGF-2 pathway in brain endothelium." Experimental cell research 315.3 (2009): 385-395.

Muñoz, Francisco J., et al. "Vitamin E but not 17β-estradiol protects against vascular toxicity induced by β-amyloid wild type and the Dutch amyloid variant." Journal of Neuroscience 22.8 (2002): 3081-3089.

Kumar-Singh, Samir, et al. "In vitro studies of Flemish, Dutch, and wild-type β-amyloid provide evidence for two-staged neurotoxicity." Neurobiology of disease 11.2 (2002): 330-340.

Sian, Aneet K., et al. "Oligomerization of β-amyloid of the Alzheimer’s and the Dutch-cerebral-haemorrhage types." Biochemical Journal 349.1 (2000): 299-308.

Miravalle, Leticia, et al. "Substitutions at codon 22 of Alzheimer's Aβ peptide induce diverse conformational changes and apoptotic effects in human cerebral endothelial cells." Journal of Biological Chemistry 275.35 (2000): 27110-27116.

Wang, Zhenzhen, et al. "Toxicity of Dutch (E22Q) and Flemish (A21G) mutant amyloid b proteins to human cerebral microvessel and aortic smooth muscle cells." Stroke 31.2 (2000): 534-8.