[Lys22] - beta - Amyloid (1 - 40), Italian Mutation

Description:

This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of β-amyloid 1-40 (E22K) aggregates more rapidly than the wild-type beta-amyloid 40.

Sequence:

DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
  • General
  • References
  • Comments (0)
  • Name [Lys22] - beta - Amyloid (1 - 40), Italian Mutation
    Category Beta-Amyloidand Related Peptides
    One Letter Code DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
    Three Letter Code {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Lys}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
    Molecular Weight 4328.900
    Application Alzheimer's Disease
    Masuda, Yuichi, et al. "Verification of the turn at positions 22 and 23 of the β-amyloid fibrils with Italian mutation using solid-state NMR." Bioorganic & medicinal chemistry 13.24 (2005): 6803-6809.
    Betts, V., et al. "A facile method for expression and purification of the Alzheimer’s disease-associated amyloid β-peptide." Neurobiol. Dis 31 (2008): 442-450.
    Masuda, Yuichi, et al. "Verification of the turn at positions 22 and 23 of the β-amyloid fibrils with Italian mutation using solid-state NMR." Bioorganic & medicinal chemistry 13.24 (2005): 6803-6809.
    Morelli, Laura, et al. "Differential degradation of amyloid β genetic variants associated with hereditary dementia or stroke by insulin-degrading enzyme." Journal of biological chemistry 278.26 (2003): 23221-23226.
    Tsubuki, Satoshi, Yoshie Takai, and Takaomi C. Saido. "Dutch, Flemish, Italian, and Arctic mutations of APP and resistance of Aβ to physiologically relevant proteolytic degradation." The Lancet 361.9373 (2003): 1957-1958.
    #[first_name]
    #[create_date]
    #[comment]
    Reply(#[reply_num])
    #[like_num]
  • #[first_name]
    #[create_date]
    #[comment]
    Reply
    #[like_num]