[Lys22] - beta - Amyloid (1 - 40), Italian Mutation
| Name | [Lys22] - beta - Amyloid (1 - 40), Italian Mutation |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Lys}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4328.900 |
| Application | Alzheimer's Disease |
| Masuda, Yuichi, et al. "Verification of the turn at positions 22 and 23 of the β-amyloid fibrils with Italian mutation using solid-state NMR." Bioorganic & medicinal chemistry 13.24 (2005): 6803-6809. |
| Betts, V., et al. "A facile method for expression and purification of the Alzheimer’s disease-associated amyloid β-peptide." Neurobiol. Dis 31 (2008): 442-450. |
| Masuda, Yuichi, et al. "Verification of the turn at positions 22 and 23 of the β-amyloid fibrils with Italian mutation using solid-state NMR." Bioorganic & medicinal chemistry 13.24 (2005): 6803-6809. |
| Morelli, Laura, et al. "Differential degradation of amyloid β genetic variants associated with hereditary dementia or stroke by insulin-degrading enzyme." Journal of biological chemistry 278.26 (2003): 23221-23226. |
| Tsubuki, Satoshi, Yoshie Takai, and Takaomi C. Saido. "Dutch, Flemish, Italian, and Arctic mutations of APP and resistance of Aβ to physiologically relevant proteolytic degradation." The Lancet 361.9373 (2003): 1957-1958. |