Adrenomedullin (1 - 50) (rat)
| Name | Adrenomedullin (1 - 50) (rat) |
| Category | Adrenomedullin Peptides |
| One Letter Code | YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19) |
| Three Letter Code | {Tyr}{Arg}{Gln}{Ser}{Met}{Asn}{Gln}{Gly}{Ser}{Arg}{Ser}{Thr}{Gly}{Cys}{Arg}{Phe}{Gly}{Thr}{Cys}{Thr}{Met}{Gln}{Lys}{Leu}{Ala}{His}{Gln}{Ile}{Tyr}{Gln}{Phe}{Thr}{Asp}{Lys}{Asp}{Lys}{Asp}{Gly}{Met}{Ala}{Pro}{Arg}{Asn}{Lys}{Ile}{Ser}{Pro}{Gln}{Gly}{Tyr}-NH2 (Disulfide bridge: 14-19) (Disulfide bridge: 14-19) |
| Molecular Weight | 5729.500 |
| Application | Cardiovascular System & Diseases |
| Roux, Benoît T., et al. "The role of ubiquitination and hepatocyte growth factor-regulated tyrosine kinase substrate in the degradation of the adrenomedullin type I receptor." Scientific reports 7.1 (2017): 1-18. |
| Walker, Christopher S., et al. "α-Calcitonin gene related peptide (α-CGRP) mediated lipid mobilization in 3T3-L1 adipocytes." Peptides 58 (2014): 14-19. |
| Talero, Elena, et al. "Vascular contribution of adrenomedullin to microcirculatory improvement in experimental colitis." European journal of pharmacology 670.2-3 (2011): 601-607. |
| Juhl, Louise, et al. "The in vivo effect of adrenomedullin on rat dural and pial arteries." European journal of pharmacology 538.1-3 (2006): 101-107. |
| Takhshid, Mohammad A., et al. "Characterization and effects on cAMP accumulation of adrenomedullin and calcitonin gene‐related peptide (CGRP) receptors in dissociated rat spinal cord cell culture." British journal of pharmacology 148.4 (2006): 459-468. |