[Gly22] - beta - Amyloid (1 - 40), Arctic Mutation
| Name | [Gly22] - beta - Amyloid (1 - 40), Arctic Mutation |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Gly}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val} |
| Molecular Weight | 4257.800 |
| Application | Alzheimer's Disease |
| Bolognesi, Benedetta, et al. "ANS binding reveals common features of cytotoxic amyloid species." ACS chemical biology 5.8 (2010): 735-740. |
| Jan, Asad, Dean M. Hartley, and Hilal A. Lashuel. "Preparation and characterization of toxic Aβ aggregates for structural and functional studies in Alzheimer's disease research." Nature protocols 5.6 (2010): 1186. |
| Solito, Raffaella, et al. "Dutch and arctic mutant peptides of β amyloid1–40 differentially affect the FGF-2 pathway in brain endothelium." Experimental cell research 315.3 (2009): 385-395. |
| Lam, A. R., et al. "Effects of the Arctic (E22→ G) mutation on amyloid β-protein folding: discrete molecular dynamics study." Journal of the American Chemical Society 130.51 (2008): 17413-17422. |
| Yamamoto, Naoki, et al. "A Ganglioside-induced Toxic Soluble Aβ Assembly ITS ENHANCED FORMATION FROM AβBEARING THE ARCTIC MUTATION." Journal of Biological Chemistry 282.4 (2007): 2646-2655. |