[Asn23] - beta - Amyloid (1 - 40), Iowa Mutation

Description:

The Iowa (D23N) mutant of Aβ 40 is naturally occurring mutant within the beta-amyloid region of b-amyloid protein precursor (APP).This mutation is associated with severe cerebral amyloid beta-protein angiopathy (CAA) in Iowa kindred.

Sequence:

DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV

General

References

Comments (0)

Name	[Asn23] - beta - Amyloid (1 - 40), Iowa Mutation
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVV
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asn}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
Molecular Weight	4328.900
Application	Alzheimer's Disease

Van Nostrand, William E., et al. "Pathogenic effects of D23N Iowa mutant amyloid β-protein." Journal of Biological Chemistry 276.35 (2001): 32860-32866.

Grabowski, Thomas J., et al. "Novel amyloid precursor protein mutation in an Iowa family with dementia and severe cerebral amyloid angiopathy." Annals of Neurology: Official Journal of the American Neurological Association and the Child Neurology Society 49.6 (2001): 697-705.

Qiang, Wei, Wai-Ming Yau, and Robert Tycko. "Structural evolution of Iowa mutant β-amyloid fibrils from polymorphic to homogeneous states under repeated seeded growth." Journal of the American Chemical Society 133.11 (2011): 4018-4029.

Tomidokoro, Yasushi, et al. "Iowa variant of familial Alzheimer’s disease: accumulation of posttranslationally modified AβD23N in parenchymal and cerebrovascular amyloid deposits." The American journal of pathology 176.4 (2010): 1841-1854.

Tycko, Robert, et al. "Evidence for novel β-sheet structures in Iowa mutant β-amyloid fibrils." Biochemistry 48.26 (2009): 6072-6084.