Amyloid β-Protein (1-46)
| Name | Amyloid β-Protein (1-46) |
| Category | Beta-Amyloidand Related Peptides |
| One Letter Code | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIV |
| Three Letter Code | {Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala}{Thr}{Val}{Ile}{Val} |
| Molecular Weight | 4926.630 |
| Application | Alzheimer's Disease |
| Zhao, Guojun, et al. "γ-Cleavage is dependent on ζ-cleavage during the proteolytic processing of amyloid precursor protein within its transmembrane domain." Journal of Biological Chemistry 280.45 (2005): 37689-37697. |
| Qi-Takahara, Yue, et al. "Longer forms of amyloid β protein: implications for the mechanism of intramembrane cleavage by γ-secretase." Journal of Neuroscience 25.2 (2005): 436-445. |
| Zhao, Guojun, et al. "Identification of a new presenilin-dependent ζ-cleavage site within the transmembrane domain of amyloid precursor protein." Journal of Biological Chemistry 279.49 (2004): 50647-50650. |