Beta - Amyloid (1 - 43)

Description:

The Beta - Amyloid (1 - 43) is the primary constituent of senile plaques and cerebrovascular deposits in Alzheimer's disease and Down's syndrome. It also acts as an inhibitor of the ubiquitin-dependent protein degradation in vitro.

Sequence:

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT

General

References

Comments (0)

Name	Beta - Amyloid (1 - 43)
Category	Beta-Amyloidand Related Peptides
One Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIAT
Three Letter Code	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}{Ile}{Ala}{Thr}
Molecular Weight	4615.200
Application	Alzheimer's Disease

Geylis, Valeria, et al. "Human monoclonal antibodies against amyloid-beta from healthy adults." Neurobiology of aging 26.5 (2005): 597-606.

Kourilov, Vitaly, and Michael Steinitz. "Magnetic-bead enzyme-linked immunosorbent assay verifies adsorption of ligand and epitope accessibility." Analytical biochemistry 311.2 (2002): 166-170.

Gregori, Luisa, et al. "Amyloid β-protein inhibits ubiquitin-dependent protein degradation in vitro." Journal of Biological Chemistry 270.34 (1995): 19702-19708.

Pike, Christian J., et al. "Neurodegeneration induced by beta-amyloid peptides in vitro: the role of peptide assembly state." Journal of Neuroscience 13.4 (1993): 1676-1687.

Yankner, Bruce A., Lawrence K. Duffy, and Daniel A. Kirschner. "Neurotrophic and neurotoxic effects of amyloid beta protein: reversal by tachykinin neuropeptides." Science 250.4978 (1990): 279-282.

Goldgaber, Dmitry, et al. "Characterization and chromosomal localization of a cDNA encoding brain amyloid of Alzheimer's disease." Science 235.4791 (1987): 877-880.